PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK23488.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 73aa    MW: 8671.87 Da    PI: 6.5153
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK23488.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM83.25.2e-26673169
        NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkya 69
               lppGfrFhPtdeel+++yL +kv +++++  ++i+evd++k+ePw+Lp+k+k +ekewyf+s rd+ky+
  PK23488.2  6 LPPGFRFHPTDEELITYYLLNKVLDSSFTG-RAIAEVDLNKCEPWQLPEKAKMGEKEWYFYSLRDRKYP 73
               79*************************999.89***************99999**************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-28373IPR003441NAC domain
PROSITE profilePS5100527.771673IPR003441NAC domain
PfamPF023652.0E-11769IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
MSSSHLPPGF RFHPTDEELI TYYLLNKVLD SSFTGRAIAE VDLNKCEPWQ LPEKAKMGEK  60
EWYFYSLRDR KYP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-241731587NAC domain-containing protein 19
3swm_B2e-241731587NAC domain-containing protein 19
3swm_C2e-241731587NAC domain-containing protein 19
3swm_D2e-241731587NAC domain-containing protein 19
3swp_A2e-241731587NAC domain-containing protein 19
3swp_B2e-241731587NAC domain-containing protein 19
3swp_C2e-241731587NAC domain-containing protein 19
3swp_D2e-241731587NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007021572.11e-42NAC domain protein, IPR003441, putative
RefseqXP_008226496.11e-42PREDICTED: protein CUP-SHAPED COTYLEDON 2-like
RefseqXP_012458045.11e-42PREDICTED: protein CUP-SHAPED COTYLEDON 2
SwissprotO040176e-40NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLA5AU943e-44A5AU94_VITVI; Putative uncharacterized protein
STRINGGLYMA12G26190.16e-42(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1758457
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.13e-41NAC family protein